PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1BL_C25B5DDB4.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 554aa    MW: 61686.2 Da    PI: 6.924
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1BL_C25B5DDB4.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.62.5e-171763148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g WT+eEde l +av+ + g++Wk++a+ ++  Rt+ qc +rwqk+l
  Traes_1BL_C25B5DDB4.2 17 KGGWTPEEDETLREAVTVFKGKNWKRVAEFFP-DRTEVQCLHRWQKVL 63
                           688*****************************.************986 PP

2Myb_DNA-binding56.85.1e-1869115148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            +g+WT+eEde +++ vk++G+  W+ Iar +  gR +kqc++rw+++l
  Traes_1BL_C25B5DDB4.2  69 KGPWTQEEDETIIQKVKEHGPTKWSVIARSLH-GRIGKQCRERWHNHL 115
                            79******************************.*************97 PP

3Myb_DNA-binding60.73.1e-19121163145
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                            + +WT eE++ lvda++++G++ W+ Ia+ ++ gRt++++k++w+
  Traes_1BL_C25B5DDB4.2 121 KEAWTLEEEQVLVDAHRMHGNK-WAEIAKLLP-GRTDNSIKNHWN 163
                            579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.3111263IPR017930Myb domain
SMARTSM007174.4E-141665IPR001005SANT/Myb domain
PfamPF002496.3E-151763IPR001005SANT/Myb domain
SuperFamilySSF466894.02E-151873IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-231975IPR009057Homeodomain-like
CDDcd001674.71E-132063No hitNo description
PROSITE profilePS5129429.11464119IPR017930Myb domain
SuperFamilySSF466899.73E-3166162IPR009057Homeodomain-like
SMARTSM007173.6E-1668117IPR001005SANT/Myb domain
PfamPF002491.4E-1669115IPR001005SANT/Myb domain
CDDcd001671.95E-1471115No hitNo description
Gene3DG3DSA:1.10.10.605.8E-2576118IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-23119170IPR009057Homeodomain-like
PROSITE profilePS5129423.014120170IPR017930Myb domain
SMARTSM007171.8E-16120168IPR001005SANT/Myb domain
PfamPF002496.3E-17121164IPR001005SANT/Myb domain
CDDcd001672.10E-13123163No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 554 aa     Download sequence    Send to blast
SYSTNIRRTS GPVRRAKGGW TPEEDETLRE AVTVFKGKNW KRVAEFFPDR TEVQCLHRWQ  60
KVLDPELIKG PWTQEEDETI IQKVKEHGPT KWSVIARSLH GRIGKQCRER WHNHLDPQIR  120
KEAWTLEEEQ VLVDAHRMHG NKWAEIAKLL PGRTDNSIKN HWNSSVRKRL DEYDTGAALP  180
VPVHVSHNDL KQVTMAPPAE NYIDLNKEPN ISLSSVIVDH SDPTHSPRVC SLKNIKGCSD  240
FLSLSLPTAQ PVTSCQASVA DDSAVALAIM GMKMNSGRDK DMELNFVCQK GLQINLPNEK  300
GLEINSVTAK PDGEIDNTGR ESTLVKEAQS FGSLCYQIPK LEDIDLVRSP VLSRHHGSEH  360
GVDGFQSPTG YATPSPTDGI QSDQLSVESI LKSAAENFPG TPSILRRRKR DKPTPSQDTD  420
FKIDANSDGF DTPKANCTTY SPHSFKTASF LSLGRLDDQQ LPSVLGKFDV SPTYRLRSKR  480
MAVLKTVEKH LDFSADAMDT CDMVGSLKSS CRNTESVNAS SDISSAQDRR INGHMIGLET  540
LTSDFAHTTQ LDAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C5e-67161705159MYB PROTO-ONCOGENE PROTEIN
1h89_C5e-67161705159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1405412RRRKRDKP
2406411RRKRDK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3635120.0AK363512.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2016D03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568309.10.0PREDICTED: cyclin-D-binding Myb-like transcription factor 1 isoform X1
RefseqXP_010231305.10.0PREDICTED: cyclin-D-binding Myb-like transcription factor 1 isoform X1
TrEMBLW5A5Q80.0W5A5Q8_WHEAT; Uncharacterized protein
STRINGMLOC_50701.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30993880
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-98myb domain protein 3r-5
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]